Protein Info for Dsui_1011 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1126 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details PF03924: CHASE" amino acids 119 to 223 (105 residues), 45.5 bits, see alignment E=3.2e-15 TIGR00229: PAS domain S-box protein" amino acids 321 to 448 (128 residues), 55.5 bits, see alignment E=6.5e-19 amino acids 451 to 573 (123 residues), 42 bits, see alignment E=9.2e-15 amino acids 580 to 695 (116 residues), 63 bits, see alignment E=3e-21 PF00989: PAS" amino acids 325 to 426 (102 residues), 32 bits, see alignment E=4.4e-11 amino acids 579 to 685 (107 residues), 51.3 bits, see alignment E=4.4e-17 PF13188: PAS_8" amino acids 325 to 363 (39 residues), 29.6 bits, see alignment (E = 1.8e-10) amino acids 579 to 627 (49 residues), 29.3 bits, see alignment (E = 2.3e-10) PF13426: PAS_9" amino acids 334 to 440 (107 residues), 36.4 bits, see alignment E=2.1e-12 amino acids 585 to 686 (102 residues), 51.3 bits, see alignment E=4.9e-17 PF08448: PAS_4" amino acids 459 to 565 (107 residues), 56.3 bits, see alignment E=1.4e-18 amino acids 581 to 687 (107 residues), 23.8 bits, see alignment E=1.7e-08 PF08447: PAS_3" amino acids 597 to 681 (85 residues), 29.7 bits, see alignment 2.6e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 695 to 858 (164 residues), 148.3 bits, see alignment E=1.7e-47 PF00990: GGDEF" amino acids 699 to 855 (157 residues), 171.7 bits, see alignment E=4.4e-54 PF00563: EAL" amino acids 876 to 1111 (236 residues), 243.1 bits, see alignment E=1.1e-75

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJJ0 at UniProt or InterPro

Protein Sequence (1126 amino acids)

>Dsui_1011 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MAKVKTGAAFGASFRLLGAGSYALLAAVLLVGSILALLLGQLEVDRRTSEARTQATAELA
AVRARLEGQIMATFSITEGIVHLLRHDGSISPERFAGMASQAIAAVPHIRNIALAPDDVI
RQVYPLAGNERALGFAYSTRPEQFATVRRARELGGPLLAGPVDLVQGGRALIHRRPVFIT
DKAGGSRYWGVASIVADVDRLLNVGGIGREGPLNLALRGRDGDGADGGMIWGDSTVFGQQ
PVLMNVSVPGGTWQLAGLPKAGWPSTNLLHSPLFLVALSNTLLLLYFVAQLMGRNSFIRE
RNAELSREIAERKEIQASLAQSEGRFRTLFEHSPDPTWIVRQGCFSEANAAALEMFGFKD
FSQFRGISPIDLSPARQPDGQTSAEKAKAMMEIAVARGLHRFEWTHQRCDGSLFPAEVTL
SAMQLNELPVLHAVVRDISERKQAEAELERQRSLLGAIVDHAPSLIYMFDTEGRLRLGNR
LFEKVIGRPRAAVEGLLRESFISPALAVQHRHNDELVMQSGQPMRFEEQAFDGGVQRTYL
TTKCPLPGPDGSLRGVLGISTDITEIKQTTEQLRLAGVVMENTADGVMITDARGVILSVN
KAFTDITGYTAAEALGQLPSLLRSDRQEPEFYRLMWETLASTGIWRGEIWNRRKNGALFP
EWLTINAVLDQEGKPVNYVGVFSDISAIKHSQDELERLAHFDPLTGLPNRTLFHDRLQHA
LERAQRYGQELAVLLLDLDGFKTVNDSLGHPTGDLLLQQAAHRFKECVRVEDTVSRLGGD
EFAIILNNLAQGTDAISVVKKLLQALQEPFDLDGTAALVTTSIGIAIAPLDGDTPEALVR
NADTAMYGAKEGGRNSYRFYQADMTRRAQERLTQERSLRRALEEGEFEVWYQPKLELADG
SLCGAEALLRWRDPARGLVSPAEFIPLAERTGLIVPIGELVLDQVCRQARQWADRGLLAG
RIAVNVAALQIERSDYAATLRQALEKHGLPATALEVEVTESLIMESPNHARQVLCDIQTL
GVTTAVDDFGTGYSSLAYLKVLPINHLKIDRAFVADLPHNANDVAIARAIIALGHSLGFH
ITAEGIETQEQLEFLRGAGCDQGQGYLFGRPMPAADFTAWMQQRRA