Protein Info for Dsui_0999 in Dechlorosoma suillum PS

Annotation: MoxR-like ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF20030: bpMoxR" amino acids 3 to 169 (167 residues), 30 bits, see alignment E=8.4e-11 PF07728: AAA_5" amino acids 34 to 162 (129 residues), 39 bits, see alignment E=2.4e-13 PF07726: AAA_3" amino acids 34 to 164 (131 residues), 203.9 bits, see alignment E=2.3e-64 PF00004: AAA" amino acids 40 to 146 (107 residues), 31.7 bits, see alignment E=5.9e-11 PF17863: AAA_lid_2" amino acids 227 to 298 (72 residues), 80.8 bits, see alignment E=1.5e-26

Best Hits

Swiss-Prot: 53% identical to YEAC_BACSU: Uncharacterized protein YeaC (yeaC) from Bacillus subtilis (strain 168)

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 61% identity to gur:Gura_0187)

Predicted SEED Role

"FIG022979: MoxR-like ATPases"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJH9 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Dsui_0999 MoxR-like ATPase (Dechlorosoma suillum PS)
MQTIQTLIDNVEQVIIGKRPVIELAVVALLCRGHLLLEDVPGTGKTMLARALAKSVALDC
KRLQCTPDLLPSDVTGVPVFNQKTTEFEFRPGPVFTNILLADEINRATPRAQSALLECME
EFHVSVDGHTYPLPPVFMVLATQNPIEMAGTYVLPEAQLDRFFMRLSTGYPSAAEEARIL
RAQAHGHPIERLQAVLGEAELLAARQAVSEVHVEDSLADYVARLVAATRAHPDLRLGASP
RGSLALCRAAQGLALLQGRDYVSPELVKTVARPVLAHRLILRPQAAAQGRHAETVLADIL
NQVPAPV