Protein Info for Dsui_0944 in Dechlorosoma suillum PS

Annotation: putative NADH:ubiquinone oxidoreductase, subunit RnfB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 71 PF00037: Fer4" amino acids 3 to 26 (24 residues), 34.6 bits, see alignment E=1.7e-12 PF13237: Fer4_10" amino acids 4 to 56 (53 residues), 29.6 bits, see alignment E=8.2e-11

Best Hits

Swiss-Prot: 61% identical to FDXN_BRADU: Ferredoxin-like protein in nif region (frxA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 70% identity to avn:Avin_10510)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIY1 at UniProt or InterPro

Protein Sequence (71 amino acids)

>Dsui_0944 putative NADH:ubiquinone oxidoreductase, subunit RnfB (Dechlorosoma suillum PS)
MAYKINASACTACGACEQECPNDAIYEKNGLFAIKADGCTECIGHYDDPQCIAACPADCI
VVDKSVPRYQA