Protein Info for Dsui_0928 in Dechlorosoma suillum PS

Annotation: cytochrome c oxidase accessory protein FixG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 196 to 213 (18 residues), see Phobius details amino acids 340 to 359 (20 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 35 to 469 (435 residues), 516.8 bits, see alignment E=2.5e-159 PF12801: Fer4_5" amino acids 89 to 127 (39 residues), 34.4 bits, see alignment 5e-12 PF13746: Fer4_18" amino acids 213 to 318 (106 residues), 149.5 bits, see alignment E=1.3e-47 PF11614: FixG_C" amino acids 355 to 471 (117 residues), 102.4 bits, see alignment E=5.7e-33

Best Hits

KEGG orthology group: None (inferred from 71% identity to dar:Daro_0681)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIW6 at UniProt or InterPro

Protein Sequence (471 amino acids)

>Dsui_0928 cytochrome c oxidase accessory protein FixG (Dechlorosoma suillum PS)
MSANAPEQPQPDNGDTGSLYEKHKTIHARTAHGRFANWRIFLVLFTQLLFYGTPWLMWND
RQAVLFHLVERKFYIFGLVLWPQDVFYLAILLIISAYGLFLVTAVAGRLFCGYACPQTVY
TEVFMWIENWIEGDRPARMKLEKAPMDARKLRIKATKHALWLILSVFTGFTLVGYFTPMS
ELLTELKTFSFGPWETFWTFFYGGFTYMMAGFMREQVCKYMCPYARFQSVMFDPDTLIIT
YDPERGEPRGTRKKGADPKALGLGECVDCGICVQVCPTGIDIRNGLQYECIGCAACIDAC
DEVMDKVNYPRGLIRYSTENAMARHLTKKEILGHVVRPRILLYSVILAAITLTTAWFIAH
RIPLKVDVIRDRGALARETDMGLIENTFTLRFMNTDEQAHRYRIKATGLDGLEVGGAAEV
DVPAATTTSLMTSLQVQPDAGKKGSNPIMFEIEAMDGSNIRIREKAVFMLP