Protein Info for Dsui_0894 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 874 PF13185: GAF_2" amino acids 45 to 189 (145 residues), 38 bits, see alignment E=8.5e-13 PF01590: GAF" amino acids 47 to 188 (142 residues), 64.4 bits, see alignment E=7.4e-21 TIGR00229: PAS domain S-box protein" amino acids 204 to 322 (119 residues), 43.9 bits, see alignment E=2.5e-15 amino acids 323 to 443 (121 residues), 84.3 bits, see alignment E=8e-28 PF13188: PAS_8" amino acids 205 to 250 (46 residues), 15.7 bits, see alignment 5.1e-06 amino acids 324 to 363 (40 residues), 27.9 bits, see alignment 7.4e-10 PF08448: PAS_4" amino acids 215 to 317 (103 residues), 44.9 bits, see alignment E=5.5e-15 amino acids 329 to 439 (111 residues), 40.8 bits, see alignment E=1.1e-13 PF13426: PAS_9" amino acids 217 to 314 (98 residues), 25.9 bits, see alignment E=4.4e-09 amino acids 334 to 436 (103 residues), 62.9 bits, see alignment E=1.3e-20 PF00989: PAS" amino acids 324 to 434 (111 residues), 65 bits, see alignment E=2.8e-21 PF08447: PAS_3" amino acids 346 to 430 (85 residues), 45 bits, see alignment E=4.8e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 446 to 606 (161 residues), 162 bits, see alignment E=1.1e-51 PF00990: GGDEF" amino acids 448 to 603 (156 residues), 174.3 bits, see alignment E=7.7e-55 PF00563: EAL" amino acids 624 to 859 (236 residues), 257.1 bits, see alignment E=6.3e-80

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIE0 at UniProt or InterPro

Protein Sequence (874 amino acids)

>Dsui_0894 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MPFPPHPPWPAFPETEQCAAGPRPGAPSRAAWLERLSRAEFLAQAGLEEIYPYLTETAAR
LLGVDRVGIWLFDDSQCTIRCADLFERAGGSHSSGQRLQEADCPAYFAALESGEPIVADD
ALHHPATRDLNDAYLTPHGIGALLDYPVRQQGRLAGVLCHEQAGPARPWNEEQRLLGVAL
ANLVSLALEHAALRQSQAQLHSLEERYLRLLEFCPTGIIHYDTELHITYSNQQFANIIGV
PLERLQDLDMAKLQDQRPLPALAAVLEGRTGRFEGEYRASLSGRQLWVSLVAAPVLDQGG
QLLGGIAIVEDATERKRAELQLRQLSRAVEQSPATIVITDTNGVIEYVNPKFTRTTGYSA
EEAVGLKPSVLKSGETPLEVYQELWSTIASGGQWEGVFHNRRRNGELYWEHATISPITDD
NQRITHFVAVKEDITEKRRQEDRIHQLAYFDELTGLPNRTLLHDRVSQCLAAAEREQETL
ALLFIDLDNFKTVNDSLGHFTGDRLLQSVAQRLKGCVRDSDTVSRLGGDEFVVVLADAQL
DGASQVARKIIDRVGQPFVIDGHQLTVTPSIGISLFPHDARDFQSLLKNADTAMYQAKES
GRNAYQFFTAEMNVLAFERLVLENALRQAVERQEFVLHYQPQVDMGSGRVIGAEALVRWL
HPELGMVPPARFIPVAEDSGLIGAIGDWVLYEACRQNRAWQEAGLPAIPVAVNLSAVQLR
QSELHESVAELLRRTGLESRYLELELTERTVMEDAEATVRCLRRLDEMGVMLSIDDFGTG
YSSLSYLKRFPIDKLKIDQSFVRDIVADADDQAIAVAIISMGHSLRLRVIAEGVETAEQL
EILHRHGCDEAQGFHFGRPMPADEFAAYLARRNA