Protein Info for Dsui_0893 in Dechlorosoma suillum PS

Annotation: rare lipoprotein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03330: DPBB_1" amino acids 110 to 197 (88 residues), 81 bits, see alignment E=6.1e-27 TIGR00413: rare lipoprotein A" amino acids 111 to 327 (217 residues), 130.9 bits, see alignment E=3.2e-42 PF05036: SPOR" amino acids 271 to 345 (75 residues), 52.8 bits, see alignment E=4.2e-18

Best Hits

Predicted SEED Role

"Rare lipoprotein A precursor" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QID9 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Dsui_0893 rare lipoprotein A (Dechlorosoma suillum PS)
MKRSLLPGLCGAFLLTLLAACGGPAPRLERAPEAGARPPAKSGMKPNPLARRGGGFYKDD
GLPEEIPENIDDIPDAEPRWEPLHRFANRPYVVLGKEYVPMTRLQPYKVRGIGSWYGKKF
HGQKTSIGEPYDMFAMTAAHPTLAIPSYARVTNVATGKSVIVRITDRGPFHADRVIDLSF
TAAYRLGYVANGSTAVEVESIVLEPGATYAAAPALEVAAIKRQTARQEARPAPAREERDP
IAEMAMAAQAQDEPAAVLAAAPAPAAAAGVGNVFLQLGAFSSQDNAESLKAKLARELDWL
TDAIQIQSKGGMHRIHVGPYRDRMEADKVAERIRLALGFKPTFVTR