Protein Info for Dsui_0875 in Dechlorosoma suillum PS

Annotation: putative branched-chain amino acid permease (azaleucine resistance)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 51 to 98 (48 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 200 to 216 (17 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details PF03591: AzlC" amino acids 30 to 170 (141 residues), 134.8 bits, see alignment E=1.4e-43

Best Hits

KEGG orthology group: None (inferred from 60% identity to ade:Adeh_2851)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIC1 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Dsui_0875 putative branched-chain amino acid permease (azaleucine resistance) (Dechlorosoma suillum PS)
MNAPAETSGPTGAGLTPRGAFLLGLRALLPLLVGVAPFGVIYGVVALQSGIPPLAAVLMS
SVVFAGSAQFLLAQLIGVGAPLLLMVGAAAVLNLRHALYSASVAPLLGHLPWRWKLALAY
LLTDEAYAAAIPYLLDPAHKAMRHWLLLGSGLALWSSWQLATLAGVLLGRGLPADLPLDF
ALPLTFIAIVVPLINSRSRLAAALVAAAVAVVAAALPYKLGLFCAALAGLVAGVLLLPRR
GIGEPRP