Protein Info for Dsui_0860 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 81 to 102 (22 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details PF04280: Tim44" amino acids 172 to 301 (130 residues), 61.8 bits, see alignment E=4.1e-21

Best Hits

KEGG orthology group: None (inferred from 60% identity to app:CAP2UW1_4349)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIA6 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Dsui_0860 hypothetical protein (Dechlorosoma suillum PS)
MKKPLIALCTLVLGLALVAPDADAARLGGGRSSGMQRSVTPQHNTAPSGTTAPKQNAAPA
QQAQPATAGAPAPQAAPKRSWLGPIAGLAAGIGLAALASHFGFGEGMANFLMIALLAMAA
VFVFRLIFRRPAAAAPRSEPLQYAGVGGPSMAPLPEVTPVGGGNAAVPAAEAAPAAAVNI
PADFDSEGFLRVAKLNFVRLQAANDQGNLDDMREFLAPEMFAEVQLQLSERGGKAQQTDV
VQLNASLLEVVSETGRHIASVRFNGLLREEKDAAPAPFDEVWHLVKPTDGSRGWMVAGIQ
QLS