Protein Info for Dsui_0842 in Dechlorosoma suillum PS

Annotation: ABC-type branched-chain amino acid transport systems, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 247 to 270 (24 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 33 to 302 (270 residues), 120.6 bits, see alignment E=1e-38 PF00005: ABC_tran" amino acids 362 to 520 (159 residues), 102.1 bits, see alignment E=6.2e-33 PF12399: BCA_ABC_TP_C" amino acids 568 to 591 (24 residues), 41.6 bits, see alignment (E = 1.1e-14)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein K01998, branched-chain amino acid transport system permease protein (inferred from 76% identity to app:CAP2UW1_4466)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI88 at UniProt or InterPro

Protein Sequence (593 amino acids)

>Dsui_0842 ABC-type branched-chain amino acid transport systems, ATPase component (Dechlorosoma suillum PS)
MMSAKLSPARAILAAFLLFLATGPLWLPEFHVTLLNYIGLYGLVALGLVLLTGVGGLTSF
GQAAFVGLGAYTTAYLTTAYGVSPWLTLLAGLGLTLAFALCLGFITLRLSGHFLPLGTIA
WGISLYFLFGNLEWLGGHTGMTGIPAVSLFGLELKDSRSFFYLIWVVLLGAMLATRNLLD
SREGRAIRALKGGTVMAEAMGVNTARSKIVIFTVAALYACVSGWLYAHLQRFVNPTPFSI
NQGVEFLFMAVIGGVAHVWGAVVGAGLITVLKQWLQDLLPELLGQSGNFEVIVFGLMMIF
VLHRARNGLWPAIARLVPAPKQERHAVAAAEPLPRRQMPAAGTVLLQAEGVTKRFGGLVA
NKDMALTVQAGEVMALIGPNGAGKSTMFNCISGVNPPSEGRISFLGQPVAGLEARDIARL
GLSRTFQHVRLLSGMTVLENVAIGAHLRGRHNYLAAGLRLERAEEARLLAEAARQIERVG
LAEHMFDAAGSLALGKQRIIEIARALAADPCLLLLDEPAAGLRYLEKQALAELLRKLRGE
GMGILLVEHDMDFVMGLADRVVVMEFGEKLAEGLPEEIQKNPAVLEAYLGGVE