Protein Info for Dsui_0824 in Dechlorosoma suillum PS

Annotation: pseudouridine synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00849: PseudoU_synth_2" amino acids 62 to 191 (130 residues), 62.4 bits, see alignment E=3e-21 TIGR00093: pseudouridine synthase" amino acids 66 to 224 (159 residues), 126.9 bits, see alignment E=3.2e-41

Best Hits

KEGG orthology group: K06183, ribosomal small subunit pseudouridine synthase A [EC: 5.4.99.12] (inferred from 64% identity to tmz:Tmz1t_0135)

Predicted SEED Role

"Ribosomal small subunit pseudouridine synthase A (EC 4.2.1.70)" (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHT0 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Dsui_0824 pseudouridine synthase family protein (Dechlorosoma suillum PS)
MQLEKLLHSQGFGTRKECRALVRNGWLEIGGVVVEDPFLEVDPEGFEFTVDDQPWRYREK
AYLMIHKPGDYECSHKPKHHRSIFTLLPEELVNRDVQCVGRLDEDTTGLLLMTDDGQFIH
QMSSPKRKVPKVYEITAKHSIDQAQIDQLLAGVLLHGEYEPVVADSCELVSDTVLRLTIT
QGKYHQVKRMLGAVGNRVEGLKRVRIGALDLPADLAPGEWRWLEAEDLEKLKPA