Protein Info for Dsui_0812 in Dechlorosoma suillum PS

Annotation: ribosomal RNA small subunit methyltransferase RsmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 signal peptide" amino acids 1 to 47 (47 residues), see Phobius details TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase" amino acids 33 to 444 (412 residues), 334 bits, see alignment E=8.6e-104 PF01029: NusB" amino acids 39 to 147 (109 residues), 39.6 bits, see alignment E=6.8e-14 PF01189: Methyltr_RsmB-F" amino acids 260 to 441 (182 residues), 187.1 bits, see alignment E=3e-59

Best Hits

Swiss-Prot: 49% identical to RSMB_VIBCH: Ribosomal RNA small subunit methyltransferase B (rsmB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 59% identity to dar:Daro_0028)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase B (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHR8 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Dsui_0812 ribosomal RNA small subunit methyltransferase RsmB (Dechlorosoma suillum PS)
MSSRNSPPAARRPSPVRSAPEPAPDSLARALLLASAAVAAVQAGRSLTEVLAQQAKGELG
PTRAQAQDLAYGALRRYGWGEAVLAALLQKPLPEPQLQSLLLCALYRLESRPEQSHTVVD
QAVAAAATLAKGNFRGVINGVLRSYLRQRPELLARAAGKPSGAWWHPDWWLSRLRRAYPR
DWEAIATAGNGQPPMTLRVNLARGSREEYQARLDAAGIAAVPLGSAALLLQKPVPVDALP
GFFDGFVSVQDWGAQRAAELLDARAGQRVLDACAAPGGKTAHILEQAGVDLLALDMDGLR
CRRVEENLSRLGLRAVVRAADARCPDDWWDGRPFDRILADVPCSASGVVRRHPDSKWLRR
ETDIAQFARVQRQILEVLWPTLAVGGRLLYATCSVFPEENSQQVSAFLARHGDARRIGID
GADELQLLPGSEHDGFYYALLEKTA