Protein Info for Dsui_0798 in Dechlorosoma suillum PS
Annotation: carbonic anhydrase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to CAN_SHIFL: Carbonic anhydrase 2 (can) from Shigella flexneri
KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 66% identity to xom:XOO_2301)MetaCyc: 52% identical to carbonic anhydrase 2 (Escherichia coli K-12 substr. MG1655)
Carbonate dehydratase. [EC: 4.2.1.1]
Predicted SEED Role
"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)
MetaCyc Pathways
- CO2 fixation into oxaloacetate (anaplerotic) (2/2 steps found)
- cyanate degradation (2/3 steps found)
- C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
- C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
- C4 photosynthetic carbon assimilation cycle, PEPCK type (8/14 steps found)
- 3-hydroxypropanoate cycle (7/13 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
- glyoxylate assimilation (4/13 steps found)
- superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.1
Use Curated BLAST to search for 4.2.1.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8QHQ4 at UniProt or InterPro
Protein Sequence (218 amino acids)
>Dsui_0798 carbonic anhydrase (Dechlorosoma suillum PS) MASSLDHLFEQNRIWSERIRSEDPEFFDRLATLQNPEYLWIGCSDSRVPANQITGLQPGE VFVHRNIGNVVVHSDLNCLSVLQYAVDVLHVKHILVVGHYGCGGVKAVLDNLRVGLVDNW LRHIQDVRQKHLAMLNAIADPAVRLDRLCELNVIEQVLNVCHATVVRDAWDRGQDLTVHG WVYGLADGLANDMNISVNSHQDTHAAYEAAIAQIGSPA