Protein Info for Dsui_0798 in Dechlorosoma suillum PS

Annotation: carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00484: Pro_CA" amino acids 38 to 189 (152 residues), 184.2 bits, see alignment E=1e-58

Best Hits

Swiss-Prot: 52% identical to CAN_SHIFL: Carbonic anhydrase 2 (can) from Shigella flexneri

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 66% identity to xom:XOO_2301)

MetaCyc: 52% identical to carbonic anhydrase 2 (Escherichia coli K-12 substr. MG1655)
Carbonate dehydratase. [EC: 4.2.1.1]

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHQ4 at UniProt or InterPro

Protein Sequence (218 amino acids)

>Dsui_0798 carbonic anhydrase (Dechlorosoma suillum PS)
MASSLDHLFEQNRIWSERIRSEDPEFFDRLATLQNPEYLWIGCSDSRVPANQITGLQPGE
VFVHRNIGNVVVHSDLNCLSVLQYAVDVLHVKHILVVGHYGCGGVKAVLDNLRVGLVDNW
LRHIQDVRQKHLAMLNAIADPAVRLDRLCELNVIEQVLNVCHATVVRDAWDRGQDLTVHG
WVYGLADGLANDMNISVNSHQDTHAAYEAAIAQIGSPA