Protein Info for Dsui_0795 in Dechlorosoma suillum PS

Annotation: putative enzyme of the cupin superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 PF05899: Cupin_3" amino acids 42 to 113 (72 residues), 60.3 bits, see alignment E=1.2e-20 PF07883: Cupin_2" amino acids 48 to 98 (51 residues), 34.6 bits, see alignment E=1.3e-12

Best Hits

KEGG orthology group: K06995, (no description) (inferred from 63% identity to azo:azo3688)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHQ1 at UniProt or InterPro

Protein Sequence (121 amino acids)

>Dsui_0795 putative enzyme of the cupin superfamily (Dechlorosoma suillum PS)
MTAPRAIHFADPLPAPTLDQPAPERCIGTPPRRTTWELYEQQGISMGVWACEPGAWKIAF
HAHRHEFFQVLEGRLQLIADSGEVREYGPGDAAIIPAGFSGVFKVIEAVKKRYVMVDQPA
G