Protein Info for Dsui_0760 in Dechlorosoma suillum PS

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 808 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details PF00672: HAMP" amino acids 180 to 227 (48 residues), 30.4 bits, see alignment 9.9e-11 PF13188: PAS_8" amino acids 253 to 306 (54 residues), 21 bits, see alignment 6.2e-08 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 379 to 542 (164 residues), 142.5 bits, see alignment E=5.3e-46 PF00990: GGDEF" amino acids 382 to 538 (157 residues), 141.8 bits, see alignment E=4.3e-45 PF00563: EAL" amino acids 561 to 794 (234 residues), 216.8 bits, see alignment E=7.1e-68

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH77 at UniProt or InterPro

Protein Sequence (808 amino acids)

>Dsui_0760 diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MGWLHTLRGKLIVSTILVEAVIIGAVLWNGLRLTEAHLLEQFDLRRKETTLLLDAALAPA
MAQRDYAAVSDILQATQAINSIDYLVMFDNDGQIIATANWDRRRPLPATDNPARLLDGNG
LQNFDLRIPMSIGGRQFGELQYGLDLGFLRQARDELQRQTILIAISGLLLSALVLASIGL
WLTRHLNRLTQASRRLARGATFQTLPDSADDDVGALTRAFNQMGGALAARVGELLASERE
QRQLAATLSAEQARLHALLSSMRLGLLFVSPEGRVVYANPAFRQLWRLEEDDTPAGMTLG
DLVQRIASDPQRLPDPYQREHLFLDDGLQWELRQSDERLLTQTSVAVPAASGQTEEGESR
LWIFEDITHERQTADRLLFMAERDPLTGLYNRSRFEGELQRLAVQLERDTSVRAALLYFD
LDEFKTVNDSFGHRAGDAVLLRIAGEVGQLLRGNEMFARLGGDEFAVVAPGADLAAAQTL
AQRIISAVAALGFEFEGTKVRLTSSLGIALLPEHARRPEEWVARADIAMYAAKHAGKNGW
RVFREELGQSAYMLAQLSWAERIQAALEQDLFELHFQGIYTTGTPVLSHLEVLLRMKDPE
HPGQYLMPGEFIPAAERNGRILDIDRWVLAAGIRTLARRTDLPGLAINISGRSFDDPGLP
DYITGLLETHRVAPQRLLVELTETAALSNMADTQRFISHIRSMGGSVCLDDFGVGFSSFA
YLKHLDADVIKIDGMFIRNLVQSREDQVFVRAIIEVARGLGKKTVAEFVEDRATYLLLGE
LGVDLAQGYHLSRPRPELPDPAAPPAAA