Protein Info for Dsui_0757 in Dechlorosoma suillum PS

Annotation: HD-GYP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 162 to 180 (19 residues), see Phobius details PF11871: DUF3391" amino acids 2 to 130 (129 residues), 129.2 bits, see alignment E=2.4e-41 PF13487: HD_5" amino acids 155 to 316 (162 residues), 105.8 bits, see alignment E=3.4e-34 PF01966: HD" amino acids 163 to 284 (122 residues), 52.6 bits, see alignment E=8.2e-18

Best Hits

KEGG orthology group: None (inferred from 70% identity to azo:azo3744)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH74 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Dsui_0757 HD-GYP domain-containing protein (Dechlorosoma suillum PS)
MIKKIAIAELKPGMFIHDLNMGWLDHNFLRNSFAVHDEADLRKVRETGVHEVYIDTAKGL
DVAHAPTSEETTRELHQRLEAIAEEEPAPLRSVALAEEMHRARKLHNEAHRIVRDMMGDI
RLGKQIEMEKVEPMVENMVDSIFRHQDALIPLSRLKTHDDYTFLHSVSVCALLVAFARTL
NLPRDTIKEIAIGGLLHDVGKAQVPESILNKPAKLTDAEFDKMKNHVVQSKIILLHTPGI
SQIALDVAAEHHERFDGTGYPNKYKGDQISLYGQMGAVVDVYDAITSNRVYHKGMPATEA
LRRLLEWSQFHFNPELVQAFIRSIGIYPTGSLVRLESGRLGVVLEQNAEKLLLPRVKVFY
HAEKRYYLPPEEVDLSLSQDRILGHENPEQWGIDMRAWMPA