Protein Info for Dsui_0748 in Dechlorosoma suillum PS

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF13379: NMT1_2" amino acids 37 to 244 (208 residues), 59.9 bits, see alignment E=5.4e-20 PF09084: NMT1" amino acids 50 to 253 (204 residues), 55.7 bits, see alignment E=9.8e-19 PF12974: Phosphonate-bd" amino acids 67 to 234 (168 residues), 29.1 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 45% identity to eba:ebA6727)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH65 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Dsui_0748 ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component (Dechlorosoma suillum PS)
MSSASAHASLLPHLTRRRLLLAAGAALLAGCGRRQQLAPLRLGSNEWPGYEPLHLARERG
YWGDAPLRLYELTSSSEVLRALRNGALDGAALTGDEALSLLADKVEVRVALVLDISHGGD
ALVARPDIRRLADLKGRRIGVENQALGAYMLTRALAQGGLAPADVSVVPLTVDTHINAYI
AGAVDAVVTFEPVLSRLQAMGAHQLFSSRQTPGEIFDLLVVREEAYRQHRATLKTLSQAW
FRVLDEFKAAPAEVAAALGRRTQSSGPELLKALDGLVLPDRQENLNLLTGATPAIAAPLQ
RLATLMQERQLLSHGVAPLRLLPADLAEVLAP