Protein Info for Dsui_0747 in Dechlorosoma suillum PS

Annotation: glutamate--cysteine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 PF08886: GshA" amino acids 17 to 419 (403 residues), 672 bits, see alignment E=1.2e-206 TIGR02049: glutamate--cysteine ligase" amino acids 17 to 422 (406 residues), 626.6 bits, see alignment E=7.5e-193

Best Hits

KEGG orthology group: K01919, glutamate--cysteine ligase [EC: 6.3.2.2] (inferred from 79% identity to dar:Daro_0011)

Predicted SEED Role

"Glutamate--cysteine ligase (EC 6.3.2.2), divergent, of Alpha- and Beta-proteobacteria type" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle (EC 6.3.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH64 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Dsui_0747 glutamate--cysteine ligase (Dechlorosoma suillum PS)
MVPHLTTALTGPLLDLEKRFLDDSTRIEQWLRSQWQEHTPPFYGSVDLRNNGFKLAPVDT
NLFPGGFNNLNPAFLPLCVHATMSAIEKICPDARNLLLIPENHTRNQFYLMNVAQLATIL
RQTGLNVRIGTLLPEITEPTTLELPNGHSLVLEPLVRTQYRLGLKDFDPCAILLNNDLSA
GAPAILQNLNEQFLLPPLHAGWAVRRKSHHFAAYDQVATDFAAHLGLDPWRINPYFAVCN
QINFHERQGEDCLAAQVDMLLARIREKYKEYGVTETPYVVVKADAGTYGMGVMTVKDASE
VTGLNRKQRNKMSVVKEGLEVSEVIIQEGVHTFESINDGVAEPVVYMIDRYVVGGFYRVH
SGRAKDENLNAPGMHFEPLAFETCCNQPEHALAPDAPPNRFYAYGVVARLALLAASVELE
NTAPAA