Protein Info for Dsui_0746 in Dechlorosoma suillum PS

Annotation: glutathione synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF02951: GSH-S_N" amino acids 1 to 120 (120 residues), 137 bits, see alignment E=5e-44 TIGR01380: glutathione synthase" amino acids 1 to 312 (312 residues), 406.9 bits, see alignment E=2.4e-126 PF02955: GSH-S_ATP" amino acids 124 to 297 (174 residues), 247.4 bits, see alignment E=9e-78 PF08443: RimK" amino acids 140 to 308 (169 residues), 42.8 bits, see alignment E=7e-15

Best Hits

Swiss-Prot: 61% identical to GSHB_BORBR: Glutathione synthetase (gshB) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K01920, glutathione synthase [EC: 6.3.2.3] (inferred from 71% identity to dar:Daro_0010)

MetaCyc: 50% identical to glutathione synthetase (Escherichia coli K-12 substr. MG1655)
Glutathione synthase. [EC: 6.3.2.3]

Predicted SEED Role

"Glutathione synthetase (EC 6.3.2.3)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Heat shock dnaK gene cluster extended (EC 6.3.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH63 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Dsui_0746 glutathione synthetase (Dechlorosoma suillum PS)
MRIAFIVDPLDQLKAYKDSSVAMMRAAERHGHEAWALQVDSLAWSQEGGVRGQALRVHTR
PDDHDWYRETGRESLALKDFDAVVMRKDPPFDVEYVTATWLLERAEAEGARIFNKPRALR
DHSEKFATAEFPQFTVPALVTRDSHALQAFIDTQRDVVMKPLDGMGGSSIFRVHRNEPNR
NVIIEVLTQLGQRTVMAQRFIPEISHGDKRILLINGKPVPYALARIPKAGETRGNLAVGG
TGVAQELSPRDRQIAESLGPVLAARGLFLVGLDVIGDWLTEINVTSPTCMVEIQQQTGFD
VAGAFITALEHACGS