Protein Info for Dsui_0740 in Dechlorosoma suillum PS

Annotation: methionine biosynthesis protein MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR02081: methionine biosynthesis protein MetW" amino acids 8 to 195 (188 residues), 235.9 bits, see alignment E=1.4e-74 PF07021: MetW" amino acids 8 to 192 (185 residues), 223.5 bits, see alignment E=7e-70 PF13489: Methyltransf_23" amino acids 15 to 167 (153 residues), 35.5 bits, see alignment E=3e-12 PF01728: FtsJ" amino acids 17 to 71 (55 residues), 24.8 bits, see alignment E=6.6e-09 PF13847: Methyltransf_31" amino acids 20 to 112 (93 residues), 34.8 bits, see alignment E=4.7e-12 PF13649: Methyltransf_25" amino acids 24 to 108 (85 residues), 40.4 bits, see alignment E=1.4e-13 PF08242: Methyltransf_12" amino acids 25 to 107 (83 residues), 30.5 bits, see alignment E=1.8e-10 PF08241: Methyltransf_11" amino acids 25 to 110 (86 residues), 43.5 bits, see alignment E=1.4e-14

Best Hits

KEGG orthology group: None (inferred from 71% identity to azo:azo3972)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH57 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Dsui_0740 methionine biosynthesis protein MetW (Dechlorosoma suillum PS)
MTNNSLDRFDFDVIAKWIAPGERVLDLGCGDGSLLKFLAQARNTHGYGVDIDPANVLACV
RNGVNVIQSNLEQGLAGFEDGFFDHAIMSLSLQTVHRTVPLLEELLRVGREAVVSFPNFG
YWLHRQAILNGRMPVSKDLPYQWYDSPNVRFFTIADFQALCEEKGIAMRELKAFDEGKEV
TEDPNFLASLAICRLGRD