Protein Info for Dsui_0738 in Dechlorosoma suillum PS

Annotation: secondary thiamine-phosphate synthase enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 TIGR00149: secondary thiamine-phosphate synthase enzyme" amino acids 10 to 139 (130 residues), 143.7 bits, see alignment E=1.3e-46 PF01894: UPF0047" amino acids 20 to 135 (116 residues), 133.1 bits, see alignment E=2.7e-43

Best Hits

Swiss-Prot: 57% identical to Y1880_SYNY3: UPF0047 protein sll1880 (sll1880) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 64% identity to bam:Bamb_5144)

Predicted SEED Role

"Uncharacterized protein sll1880 (YjbQ family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH55 at UniProt or InterPro

Protein Sequence (139 amino acids)

>Dsui_0738 secondary thiamine-phosphate synthase enzyme (Dechlorosoma suillum PS)
MPQALASIHIATRGRGLHEFTRQARDFVAASGLHQGLLTVFCRHTSASLLIQENADPSVQ
RDLERFFAKLVQDGDPAFEHDLKGPDDMPAHIRAALTQTSLGIPVSDGRLLLGTWQGLYL
YEHRHRGHSREVVLHLLGD