Protein Info for Dsui_0734 in Dechlorosoma suillum PS

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF00583: Acetyltransf_1" amino acids 54 to 156 (103 residues), 45.7 bits, see alignment E=1.5e-15 PF13508: Acetyltransf_7" amino acids 69 to 158 (90 residues), 42.3 bits, see alignment E=1.6e-14 PF13673: Acetyltransf_10" amino acids 79 to 161 (83 residues), 28.8 bits, see alignment E=2.2e-10 PF08445: FR47" amino acids 107 to 159 (53 residues), 26.1 bits, see alignment E=1.4e-09

Best Hits

KEGG orthology group: None (inferred from 54% identity to geo:Geob_1278)

Predicted SEED Role

"Acetyltransferase, GNAT family (EC 2.3.1.-)" (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH51 at UniProt or InterPro

Protein Sequence (179 amino acids)

>Dsui_0734 acetyltransferase (Dechlorosoma suillum PS)
MSLSCTDSSCGSSCEERPLRLALRPIEAGDRELLFRIYASTREAERQLLDWAPVQWEAFL
RQQFGFQHDQYMVAYQNPSFDLVLLEDEPVGRLYVDRRDDEIRVIDIALLEEFRCRGIGG
RLLRTLIAEAETGGRFLGLHVEKNNPVLDFYRRLGFQEVVDRGVYLYMTRLPQHQGGAS