Protein Info for Dsui_0732 in Dechlorosoma suillum PS

Annotation: microcystin-dependent protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF07484: Collar" amino acids 6 to 62 (57 residues), 100.3 bits, see alignment E=2.3e-33

Best Hits

KEGG orthology group: None (inferred from 48% identity to mno:Mnod_4880)

Predicted SEED Role

"Microcystin dependent protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH49 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Dsui_0732 microcystin-dependent protein (Dechlorosoma suillum PS)
MEGYLGEIRMFAGDYAPQGWALCNGATLPISGNEALFSLLGTTYGGNGSNNFALPDLRGR
APMSTGTGVIAGTGQSLTPRALGNSVGSEMVALNQNNLPAHTHPMPAGGPGTTNAPAGKL
PGTAASNLYSQTTTAAANMNPAMVSPAGGGGLPHNNMMPTTCINFIIALSGIYPTAG