Protein Info for Dsui_0720 in Dechlorosoma suillum PS

Annotation: ABC-2 type transporter, NodJ family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details TIGR01291: ABC-2 type transporter, NodJ family" amino acids 18 to 264 (247 residues), 274.8 bits, see alignment E=3.6e-86 PF01061: ABC2_membrane" amino acids 23 to 227 (205 residues), 82.8 bits, see alignment E=2.5e-27 PF12698: ABC2_membrane_3" amino acids 68 to 257 (190 residues), 40.4 bits, see alignment E=2e-14

Best Hits

Swiss-Prot: 54% identical to NODJ_RHILV: Nodulation protein J (nodJ) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K09694, lipooligosaccharide transport system permease protein (inferred from 76% identity to dar:Daro_4165)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH37 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Dsui_0720 ABC-2 type transporter, NodJ family (Dechlorosoma suillum PS)
MNAATSSPSLYAPPRLSARWFPVWQRNFLVWRKLALPSILGNLADPLIYMLGLGYGLGSM
LPEVAGTSYVAFLAAGTVCASTMNAATFEALYSAFSRMHVQKTWEAMLNAPLELEDVMLG
ELIWAATKSLLSGCAILTVIFVLGLSHSPLALGVLPVILLTGLAFAALGLIVNALAPSYD
FFMYYFTLFITPTMLLSGVFFPREQLPVLVQGLTEALPLTHAVQLVRPLLQGQVPANALL
HVAVLLAITAVAFLVALVLTRRRLLR