Protein Info for Dsui_0714 in Dechlorosoma suillum PS

Annotation: 6,7-dimethyl-8-ribityllumazine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00885: DMRL_synthase
  • amino acids 18 to 153 (136 residues), 166.8 bits, E=1.3e-53
• TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase
  • amino acids 19 to 151 (133 residues), 136.5 bits, E=3.1e-44

Best Hits

Swiss-Prot: 73% identical to RISB_AZOSB: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Azoarcus sp. (strain BH72)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 77% identity to dar:Daro_3738)

MetaCyc: 48% identical to 6,7-dimethyl-8-ribityllumazine synthase monomer (Bacillus subtilis)
LUMAZINESYN-RXN [EC: 2.5.1.78]

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

See G8QH31 at UniProt or InterPro

Protein Sequence (157 amino acids)

>Dsui_0714 6,7-dimethyl-8-ribityllumazine synthase (Dechlorosoma suillum PS)
MARYDNIPEHDINLNGAGLKVGIVMARFTLDVCEGLLSACTAELQRLGVAAGDITIATVP
GALEIPLVLQTMAQTGKYDALVALGAVIRGETYHFEVVSNDSCRGVLEVQLKTGVPIANG
ILTTENDDQALVRMQVKGADCAQAAVEMANLLKAVGK