Protein Info for Dsui_0705 in Dechlorosoma suillum PS

Annotation: ABC-type (unclassified) transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR04406: LPS export ABC transporter ATP-binding protein" amino acids 12 to 248 (237 residues), 389.8 bits, see alignment E=1.9e-121 PF00005: ABC_tran" amino acids 28 to 173 (146 residues), 122.7 bits, see alignment E=1.8e-39 PF12399: BCA_ABC_TP_C" amino acids 221 to 246 (26 residues), 31 bits, see alignment (E = 1.5e-11)

Best Hits

Swiss-Prot: 63% identical to Y382_RHIME: Uncharacterized ABC transporter ATP-binding protein R00382 (R00382) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06861, lipopolysaccharide export system ATP-binding protein [EC: 3.6.3.-] (inferred from 82% identity to dar:Daro_4150)

MetaCyc: 63% identical to lipopolysaccharide transport system ATP-binding protein (Brucella abortus 2308)
TRANS-RXN2B4Q-128 [EC: 7.5.2.5]

Predicted SEED Role

"Lipopolysaccharide ABC transporter, ATP-binding protein LptB" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH22 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Dsui_0705 ABC-type (unclassified) transport system, ATPase component (Dechlorosoma suillum PS)
MSEQNPDLIAKLSANNLKKRYKSRTVVHDVSFEVGSGEVVGLLGPNGAGKTTCFYMIVGL
VPSDGGSIQLQNQEVTHFPIHKRAHLGISYLPQEASVFRKLNVEENIRAVLELQKLPKHE
IDLRLEELLEELHIGHIRASNAAALSGGERRRVEIARALATSPRFILLDEPFAGVDPIAV
LEIQKIIRFLKDRSIGVLITDHNVRETLGICDRAYIINEGRVLASGRPDEIVYNEDVRKV
YLGESFRL