Protein Info for Dsui_0704 in Dechlorosoma suillum PS

Annotation: RNA polymerase sigma-54 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 PF00309: Sigma54_AID" amino acids 5 to 48 (44 residues), 61.7 bits, see alignment 7.2e-21 TIGR02395: RNA polymerase sigma-54 factor" amino acids 9 to 490 (482 residues), 472.5 bits, see alignment E=7.6e-146 PF04963: Sigma54_CBD" amino acids 130 to 323 (194 residues), 203 bits, see alignment E=5.5e-64 PF04552: Sigma54_DBD" amino acids 336 to 490 (155 residues), 220.4 bits, see alignment E=1.6e-69

Best Hits

Swiss-Prot: 57% identical to RP54_CUPNH: RNA polymerase sigma-54 factor (rpoN) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K03092, RNA polymerase sigma-54 factor (inferred from 67% identity to dar:Daro_4149)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH21 at UniProt or InterPro

Protein Sequence (492 amino acids)

>Dsui_0704 RNA polymerase sigma-54 factor (Dechlorosoma suillum PS)
MKPTLQLKLSQHLALTPQLQQSIRLLQLSTLELEQELEKYLLENPLLEREDENYEPSYSG
SEGEYAGSTAEAAAEGPREGDSGESGEGADSHGPEEVRDDSRDSLGEGEDWFAEGSYPSA
SRDEDEDSDFQEVQAANTSLRDHLNWQLGLMQLSERDRQLVSFLIEALDEDGYLTQPLEE
LQEALPEELEIDLDDLQIALRHLQHLDPTGVGARTPGECLALQLEALPADEVRDQALKLV
RHHLELLAGRDFTKLKKLLGCDDERLRAVTNLVKSLNPRPGAQYAPLDARYITPDVVVKK
VRNQWTASINPDAYPRLRINRLYAEILSKQRGSSLSGQLQEARWLIKNVQQRFDTILRVS
QAILDRQRQFFEHGEVAMRPLVLREIAETLGLHESTVSRVTTQKYMATPRGIFELKYFFG
SHVATDTGGACSATAIRALIKQLVAAEDPRKPLSDSQISEILGQQGIVVARRTIAKYREA
LNISPANLRKSI