Protein Info for Dsui_0695 in Dechlorosoma suillum PS

Annotation: putative ATPase of the PP-loop superfamily implicated in cell cycle control

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF01171: ATP_bind_3" amino acids 34 to 197 (164 residues), 52.7 bits, see alignment E=2.3e-18

Best Hits

Swiss-Prot: 80% identical to TTCA_DECAR: tRNA-cytidine(32) 2-sulfurtransferase (ttcA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K14058, tRNA 2-thiocytidine biosynthesis protein TtcA (inferred from 80% identity to dar:Daro_4143)

MetaCyc: 66% identical to tRNA cytosine32 2-sulfurtransferase TtcA (Escherichia coli K-12 substr. MG1655)
2.8.1.M2 [EC: 2.8.1.M2]

Predicted SEED Role

"tRNA(Cytosine32)-2-thiocytidine synthetase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGM5 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Dsui_0695 putative ATPase of the PP-loop superfamily implicated in cell cycle control (Dechlorosoma suillum PS)
MERSNTLQRIEKWLLRETGKAIADYNMIEEGDTVLVCVSGGKDSHTLLHLLRILQAKAPI
NFRLIAMNLDQKQPGFPAEVLPAYFEKTGVDFRIIEADTYSVVKEKIPEGKTTCSLCSRL
RRGIIYRTAKELGANKIALGHHRDDMVHTLFLNLIFGGKLKAMPPKLVTDDGAHVVIRPL
AYCAESDIARYSRGMEFPIIPCNLCGSQDNLQRQKIREMMQEWDQKFPGRTEAVFSALQN
VVPSHLADTKLFDFKGLKAGLTPAAEGDTLFDPPELPPMLAPRGPLDGDDFPLPVVAGA