Protein Info for Dsui_0676 in Dechlorosoma suillum PS

Annotation: short-chain dehydrogenase of unknown substrate specificity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 6 to 190 (185 residues), 135.9 bits, E=2.6e-43
• PF08659: KR
  • amino acids 6 to 184 (179 residues), 35.1 bits, E=2.7e-12
• PF13561: adh_short_C2
  • amino acids 10 to 190 (181 residues), 112.3 bits, E=5.6e-36

Best Hits

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 78% identity to dar:Daro_3863)

Predicted SEED Role

"Oxidoreductase, short-chain dehydrogenase/reductase family (EC 1.1.1.-)" (EC 1.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Carotenoid biosynthesis - General
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.-

Sequence Analysis Tools

See G8QGK6 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Dsui_0676 short-chain dehydrogenase of unknown substrate specificity (Dechlorosoma suillum PS)
MASLKVFITGASSGIGAALARHYAEQGATLGLAARRQQALTDLLADLPGHHAAYALDVSD
APALAAAAADFTARHGAPDIVIANAGVSVGTLSECPEDLAAFRKVMDTNVYGMAATFVPF
IGPMAAAGGDRRLVGIASVAGIRGLPGAEAYSASKAAAIAYLESLRLEMAPKGIKVVTIA
PGYIETPMTAINPYPMPFLLPAAEAARRFARAVAKGTSYTVIPWQMGVVAKVLRLLPNWL
YDRLFTQAPRKPRGLLD