Protein Info for Dsui_0671 in Dechlorosoma suillum PS

Annotation: arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00491: Arginase
  • amino acids 6 to 284 (279 residues), 206 bits, E=4.1e-65

Best Hits

KEGG orthology group: K01476, arginase [EC: 3.5.3.1] (inferred from 52% identity to dar:Daro_2468)

Predicted SEED Role

"Arginase (EC 3.5.3.1)" in subsystem Arginine and Ornithine Degradation (EC 3.5.3.1)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• L-arginine degradation VII (arginase 3 pathway) (2/2 steps found)
• putrescine biosynthesis III (2/2 steps found)
• urea cycle (4/5 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-arginine degradation VI (arginase 2 pathway) (3/4 steps found)
• superpathway of putrescine biosynthesis (3/4 steps found)
• L-canavanine degradation I (1/2 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• superpathway of polyamine biosynthesis I (5/8 steps found)
• L-N^δ-acetylornithine biosynthesis (4/7 steps found)
• L-arginine degradation I (arginase pathway) (1/3 steps found)
• superpathway of polyamine biosynthesis II (4/8 steps found)
• superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (4/16 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.1

Sequence Analysis Tools

See G8QGK1 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Dsui_0671 arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase (Dechlorosoma suillum PS)
MHRTLRLIGAASGVGAQDPGCHAGPTALHRAHAFDDLQRRPDLSWGETLFPRQALGGRVA
EVADLCQRLAEAVRQARERGETPVVLGGDHSCAIGTWSGVRAASPAPVGLLWLDAHLDSH
TPESTHSGALHGMPLACLLGQGDRRLVTVGGPGPKLLPGHVALIGVRSYEPEEREFLDRL
GVRVFTIDEVRQRGLPAVFGEALARVRQAPGGYGVSLDLDVFDPREAPGVGSPEPAGLSQ
TELMPALAGLAGDPALLALEVMEFNPDRDAGGRTAALLARLIGAVFPRRHGA