Protein Info for Dsui_0666 in Dechlorosoma suillum PS

Annotation: Na+/proline symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 39 to 63 (25 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 117 to 145 (29 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 227 to 244 (18 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 316 to 341 (26 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details amino acids 420 to 439 (20 residues), see Phobius details amino acids 445 to 466 (22 residues), see Phobius details PF00474: SSF" amino acids 32 to 428 (397 residues), 129 bits, see alignment E=1.1e-41

Best Hits

KEGG orthology group: None (inferred from 75% identity to nde:NIDE3595)

Predicted SEED Role

"sodium-solute symporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGJ7 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Dsui_0666 Na+/proline symporter (Dechlorosoma suillum PS)
MTTLLAFVILYLLVSIGIGLFAATRVHSAKDFAVAGRSLPLPVVTATVFATWFGAEAVLG
VSATFVKEGLGGVVADPFGASLCLILAGLFFASKLYRMNLLTIGDYYRLRYNRTVEVLTT
LCVVVSYLGWVSAQIKALGLVFFVVTGGAVSQEAGMILGALIVLTYTTFGGMFSVAILDF
VQITVIMGGMLYIGYVISGLTGGVGAVVGHAAAAGKLDFFPKGGLEVWVPFIGAWMTMML
GSIPQQDVFQRITSARNEKTAIRGSVLGGSLYFAFAFVPMFLAYAATLIDPAMFGDLLEQ
DSQLVLPTLILQHTPVFAQVVFFGALLSAIMSCSSATLLAPSVAFSENILRGGFPRMPDR
TFLLAMRTVIVCFAGTVLLFALNSNESIFHMVENAYKITLVTAFIPLFAGLYWKRANTQG
ALFAIFSGFFTWILMEVLGSEDATWPPQVLGFLVAGVAMVAGSLLPRVVGQPTPVPFGHE
HHAAGLTHHLGDHPHHHDGR