Protein Info for Dsui_0663 in Dechlorosoma suillum PS

Annotation: thiamine-phosphate pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details PF02581: TMP-TENI" amino acids 9 to 188 (180 residues), 186 bits, see alignment E=2.1e-59 TIGR00693: thiamine-phosphate diphosphorylase" amino acids 9 to 200 (192 residues), 182.4 bits, see alignment E=3e-58

Best Hits

Swiss-Prot: 62% identical to THIE_DECAR: Thiamine-phosphate synthase (thiE) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 62% identity to dar:Daro_3901)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGJ4 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Dsui_0663 thiamine-phosphate pyrophosphorylase (Dechlorosoma suillum PS)
MLKRPRPGLYAVTPDGLETPRLLMLAEAALAAGIPLLQYRDKSGDDARRREQATALLALC
RRHGTRLIINDDAALAREVDADGVHLGGEDGDLAAARALLGPDKLIGASCYADFARAQAA
AAGANYVAFGAMYASPTKPQAPRAPFNLVTRARQELPGVQVAAIGGITLDNAAPVIAAGA
QFVAVITDLFEAPDVTARAAAYQRLFAESAAHELS