Protein Info for Dsui_0651 in Dechlorosoma suillum PS

Annotation: tyrosine recombinase XerC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR02224: tyrosine recombinase XerC" amino acids 9 to 300 (292 residues), 353.4 bits, see alignment E=5.4e-110 PF02899: Phage_int_SAM_1" amino acids 9 to 90 (82 residues), 62.5 bits, see alignment E=3.7e-21 PF00589: Phage_integrase" amino acids 113 to 286 (174 residues), 151.2 bits, see alignment E=2.6e-48

Best Hits

Swiss-Prot: 53% identical to XERC_RALPJ: Tyrosine recombinase XerC (xerC) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 72% identity to dar:Daro_0194)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGI2 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Dsui_0651 tyrosine recombinase XerC (Dechlorosoma suillum PS)
MDGHSLAGAFLDELATQRRQSPHTVSNYRRDLGKLLALAAELPGSPGLGELQSHHIRRFV
GLLHGRGLAGRSLARSLSAWRVFYRWLGRHGHAGHNPCEGVRPPKSPKALPRTLSPDETA
RLLETSIDPDDPQELRDQAMFELFYSSGLRLAELAELDVDALTDIGGGEVRVHGKRDKER
VVPVGSKARQALAAWMARRPELARPEEKALFVGARGRRIAHGIIQQRLSRRALLAGLPSH
VHPHMLRHSFASHVLQSSGDLRAVQEMLGHASIASTQVYTHLDFQHLAQVYDTAHPRAKR
K