Protein Info for Dsui_0649 in Dechlorosoma suillum PS

Annotation: diaminopimelate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR00652: diaminopimelate epimerase" amino acids 4 to 274 (271 residues), 309.5 bits, see alignment E=1e-96 PF01678: DAP_epimerase" amino acids 5 to 125 (121 residues), 110.7 bits, see alignment E=2.3e-36 amino acids 154 to 268 (115 residues), 108.9 bits, see alignment E=9e-36

Best Hits

Swiss-Prot: 75% identical to DAPF_DECAR: Diaminopimelate epimerase (dapF) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 78% identity to app:CAP2UW1_4173)

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGI0 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Dsui_0649 diaminopimelate epimerase (Dechlorosoma suillum PS)
MKLEFTKMHGLGNDFVVLDGVRQNITLTPAQLRFLADRNFGVGCDQILLVEKPGQAGVDF
RYRIFNADGSEVEQCGNGARCFVRFVHEQGLTDKREIKVETKSGIISPRLEADGNVTVDM
GKPVFAPDRIPFVSPTDAVIQPLQVGDQEVAITAVSMGNPHAVQVVEDVDTAPVAIQGPM
IESHPRFPQRVNAGFLQVVDRHSVRLRVYERGAGETLACGTGACAAVVAGISRDLLDSPV
RVSTRGGELSIAWNGPGTPVHMTGPAVTVFSGEIEL