Protein Info for Dsui_0642 in Dechlorosoma suillum PS

Annotation: adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 PF05221: AdoHcyase" amino acids 6 to 465 (460 residues), 488.2 bits, see alignment E=1.2e-150 TIGR00936: adenosylhomocysteinase" amino acids 7 to 458 (452 residues), 614.9 bits, see alignment E=3.3e-189 PF00670: AdoHcyase_NAD" amino acids 227 to 386 (160 residues), 273.8 bits, see alignment E=8.6e-86 PF02826: 2-Hacid_dh_C" amino acids 246 to 336 (91 residues), 29.3 bits, see alignment E=8.2e-11

Best Hits

Swiss-Prot: 89% identical to SAHH_AROAE: Adenosylhomocysteinase (ahcY) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 90% identity to tmz:Tmz1t_3842)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGH3 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Dsui_0642 adenosylhomocysteinase (Dechlorosoma suillum PS)
MAEFKDYVIADLGLSAWGRKEIKIAETEMPGLMAIREEYAKSQPLKGARITGSLHMTIQT
AVLIETLVALGAEVRWASCNIFSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTHRIFEW
ADGGYSNMILDDGGDATLLLHLGAKAEKDISVLAKPGSEEETILFAAIKAKLAQDPTWYS
VRLEKIKGVTEETTTGVHRLYQMHARGDLKFPAINVNDSVTKSKFDNLYGCRESLVDGIK
RATDVMVAGKIAVVCGYGDVGKGSAQALRALSAQVWVTEIDPICALQAAMEGYRVVTMEY
AADKADIFVTTTGNFHVITHDHMVKMKNNAIVCNIGHFDNEIDVASLEQYQWEEIKPQVD
HVIFPDGKRIILLAKGRLVNLGCATGHPSYVMSSSFANQTIAQIELFTKTADYPVGVYTL
PKHLDEKVARLQLKTLNVQLTTLTQQQADYIGVPVQGPYKADHYRY