Protein Info for Dsui_0640 in Dechlorosoma suillum PS

Annotation: 5,10-methylenetetrahydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF02219: MTHFR" amino acids 3 to 275 (273 residues), 300.3 bits, see alignment E=7.4e-94 TIGR00676: methylenetetrahydrofolate reductase [NAD(P)H]" amino acids 6 to 274 (269 residues), 330.4 bits, see alignment E=4.3e-103

Best Hits

Swiss-Prot: 43% identical to METF_AQUAE: 5,10-methylenetetrahydrofolate reductase (metF) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K00297, methylenetetrahydrofolate reductase (NADPH) [EC: 1.5.1.20] (inferred from 81% identity to dar:Daro_0183)

MetaCyc: 43% identical to 5,10-methylenetetrahydrofolate reductase (Escherichia coli K-12 substr. MG1655)
RXN-22438 [EC: 1.5.1.54]

Predicted SEED Role

"5,10-methylenetetrahydrofolate reductase (EC 1.5.1.20)" in subsystem Methionine Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 1.5.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.20 or 1.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGH1 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Dsui_0640 5,10-methylenetetrahydrofolate reductase (Dechlorosoma suillum PS)
MNDKTFSIEFFPPQTAEGVEKLRLVRDKLAALKPAFFSVTYGAGGSTRERTFSTVREIVA
AGLDAAPHLSCIGSSRESIRGILAEFQGEGIRRVVALRGDLPSGMADPGEFRYANELVEF
IRAETGDHFHIEVAAYPEWHPQARSADDDLQAFVRKVNAGANSAITQYFYNADAYFHFVD
AVRAAGVTIPIVPGIMPIASFAKLARFSDACGAEIPRWMRKKFEGFGDDADSIKAFGLDV
VTELCQKLLAGGAPGLHFYSMNQSGLTSEIWQRLGLGNR