Protein Info for Dsui_0636 in Dechlorosoma suillum PS

Annotation: amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 24 to 131 (108 residues), 70.2 bits, see alignment E=9e-24 PF00528: BPD_transp_1" amino acids 44 to 237 (194 residues), 95.3 bits, see alignment E=2e-31

Best Hits

Swiss-Prot: 61% identical to GLTJ_ECOLI: Glutamate/aspartate import permease protein GltJ (gltJ) from Escherichia coli (strain K12)

KEGG orthology group: K10003, glutamate/aspartate transport system permease protein (inferred from 74% identity to app:CAP2UW1_1094)

MetaCyc: 61% identical to glutamate/aspartate ABC transporter membrane subunit GltJ (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGG7 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Dsui_0636 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family (Dechlorosoma suillum PS)
MNYNWNWSVFLTPVPSGETTYLGWLFTGLQWTVALSLSAWVIALVVGSIVGVLRTVPNRW
LSGFAAVYVECFRNVPLLVQLFSWYFVLPELLPPALGNAYKQSDPLLQQFLAAMLCLGLF
TAARVAEQVRAGIESLPRGQRNAGLAMGFTLAQVYRHVLLPMAFRIIVPPLTSEFLNIFK
NSAVATTIGLIELSRQAQQLVDYTAQPYEAFIAVTLLYVCINVTVMFLMRRLEEKVRVPG
FIGGK