Protein Info for Dsui_0634 in Dechlorosoma suillum PS

Annotation: putative permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 45 to 67 (23 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 279 to 296 (18 residues), see Phobius details PF00892: EamA" amino acids 11 to 145 (135 residues), 58.2 bits, see alignment E=5.6e-20 amino acids 161 to 296 (136 residues), 62.8 bits, see alignment E=2.1e-21

Best Hits

KEGG orthology group: None (inferred from 78% identity to app:CAP2UW1_1622)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGG5 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Dsui_0634 putative permease, DMT superfamily (Dechlorosoma suillum PS)
MPWKHWNSDRIGVALAVLAAFGFSFKAIFVKLAYAAAPVDAVTLLSLRMVFSLPAFLWIG
FTAGNAIPLTRRDWGTLVVLGVLGYYASSMLDFLGLQYISAGLERLILFTYPTLTVLIGV
LFMGQSLEKRQVGALLLSYAGIGLAFAHDLQLGGDVATLLTGAAFVFGSALTYAIYSAGA
EPAIRRLGSARFAALAMLVSTTATQLHFFATQPLSALVQPLPIYLYGAAMALFSTVLPIL
WQSAAIRRIGAARSVLIGTLGPVLTIFFSWWLLQEPVSAAQLAGAGLVLAGVLLVSRSKR
KPA