Protein Info for Dsui_0606 in Dechlorosoma suillum PS

Annotation: putative N6-adenine-specific DNA methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF22020: RlmL_1st" amino acids 3 to 57 (55 residues), 64.9 bits, see alignment 7.9e-22 PF02926: THUMP" amino acids 69 to 153 (85 residues), 80.6 bits, see alignment E=1.3e-26 PF01170: UPF0020" amino acids 162 to 369 (208 residues), 155.7 bits, see alignment E=1.9e-49

Best Hits

Swiss-Prot: 47% identical to RLML_NEIMB: Ribosomal RNA large subunit methyltransferase L (rlmL) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K07444, putative N6-adenine-specific DNA methylase [EC: 2.1.1.-] (inferred from 61% identity to app:CAP2UW1_3603)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmL EC 2.1.1.-)"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFZ5 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Dsui_0606 putative N6-adenine-specific DNA methylase (Dechlorosoma suillum PS)
MFKLFATCPRGLEALLAEDLTAAGASDIRIVASGVACRGTWETVYRTNLNSRIATRLMLQ
LSFGKYLKEEDIYKQASKIDWPRHFDVSRTIRVYVTAIKSPLKSLEFITLRIKDAVCDVF
RDQCGERPSVDTREPEVRIHAFLTAEDCTLYLDTTGAPLYQRGYRQKTVEAPLKENLAAG
ILRLAGWQPGTVLLDPMCGSGTFLLEAAQQVCNIAPGARRSFAFENLKGFDAQLWQRLKN
AAVQGERKPAGKPTLFGRDVSPSAYRSALANLDRAGLLPAVDLAVGDILETAPPPEAGLM
VCNPPYGERLEELDNLLAFYPQLGTALKQKYAGWTCYFLTADPALPKGVGLKPGKKTPLY
NGALECRLYQFKMVAGFNRRKKPGEEESGE