Protein Info for Dsui_0599 in Dechlorosoma suillum PS

Annotation: response regulator of the LytR/AlgR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF13596: PAS_10" amino acids 4 to 98 (95 residues), 32.7 bits, see alignment E=2.2e-11 PF00989: PAS" amino acids 5 to 107 (103 residues), 30.3 bits, see alignment E=8.9e-11 PF08448: PAS_4" amino acids 11 to 105 (95 residues), 40.8 bits, see alignment E=5.9e-14 PF04397: LytTR" amino acids 140 to 235 (96 residues), 63.3 bits, see alignment E=5.3e-21

Best Hits

Swiss-Prot: 36% identical to RCOM1_PARXL: Heme-containing CO-sensing transcriptional regulator RcoM 1 (rcoM1) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: None (inferred from 36% identity to bxe:Bxe_A2142)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFY8 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Dsui_0599 response regulator of the LytR/AlgR family (Dechlorosoma suillum PS)
MESLEYLLQKMDPGVVMLDREGRIRQLNPAARQLLQRYHPALEGRAVVDLHPEPSRRKIA
WLLQEAAAGDTPVPVTMTINTPDRPLLLSISRLESSDGAGEAAAGFCLLLYDYRGLTALP
QAAAEEGRLAKLPVLLQGGTALVDPAEVVHLQAEGHYARLYTARESFLCHLSLAQLERRL
DPEQFLRIHRRHLIAVAHAARLERQEGRPSVVMATFPASRLPIGRSRAAAVAARLGW