Protein Info for Dsui_0578 in Dechlorosoma suillum PS

Annotation: homocitrate synthase NifV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 PF00682: HMGL-like" amino acids 4 to 261 (258 residues), 262.8 bits, see alignment E=2e-82 TIGR02660: homocitrate synthase" amino acids 4 to 365 (362 residues), 535.5 bits, see alignment E=3.9e-165

Best Hits

Swiss-Prot: 60% identical to NIFV_AZOVI: Homocitrate synthase (nifV) from Azotobacter vinelandii

KEGG orthology group: K01655, homocitrate synthase [EC: 2.3.3.14] K02594, homocitrate synthase NifV (inferred from 66% identity to hse:Hsero_2835)

MetaCyc: 60% identical to homocitrate synthase monomer (Azotobacter vinelandii)
Homocitrate synthase. [EC: 2.3.3.14]

Predicted SEED Role

"Homocitrate synthase (EC 2.3.3.14)" in subsystem Nitrogen fixation (EC 2.3.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFW7 at UniProt or InterPro

Protein Sequence (384 amino acids)

>Dsui_0578 homocitrate synthase NifV (Dechlorosoma suillum PS)
MTTITINDTTLRDGEQTAGVAFTAAEKLAIAQALAAAGVPEMEVGIPAMGEQEQEVIRAI
AGLGLSSRLMVWGRMCAADLEVTRRCNAHIVNLSIPVSDQQIRHKLNKDHRWVLDSIRRF
VPEARAAGLEVCVGGEDSSRADLDFLHRVMEAAQAAGARRFRFADTLGVLDPFITHQRIA
ALRARSDLEIEIHAHDDLGLATANTLAAVTAGATHINTTVNGLGERAGNAPLEESVIALR
HLYDIDSGVDPLQLPAISDLVAKASGRPVAVNKSIVGANVFTHEAGIHVDGLAKNPANYQ
AFDPAEVGKGHRIVLGKHSGSTAVIHAYKDLGIDIDEGMARRILSRVRSYAMAFKRPPGF
RELMSYYLEGMQGSGRPAPRLHVV