Protein Info for Dsui_0577 in Dechlorosoma suillum PS

Annotation: Nitrogen fixation protein NifW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF03206: NifW" amino acids 4 to 94 (91 residues), 112.1 bits, see alignment E=7.7e-37

Best Hits

Swiss-Prot: 55% identical to NIFW_LEPCP: Nitrogenase-stabilizing/protective protein NifW (nifW) from Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)

KEGG orthology group: K02595, nitrogen fixation protein NifW (inferred from 56% identity to hse:Hsero_2836)

Predicted SEED Role

"Nitrogenase stabilizing/protective protein NifW" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFW6 at UniProt or InterPro

Protein Sequence (110 amino acids)

>Dsui_0577 Nitrogen fixation protein NifW (Dechlorosoma suillum PS)
METLMDELQQLSTAEEFLDYFGLEYDPAVVSVSRLHILKRFNQYLAREGGLAGLNEGLSR
IKCRELLARAYTDFVHSSGIEQKVFKVFQQGVQRVSVDSLRRSLGEASHA