Protein Info for Dsui_0571 in Dechlorosoma suillum PS

Annotation: ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF01257: 2Fe-2S_thioredx" amino acids 22 to 88 (67 residues), 25.6 bits, see alignment E=4.8e-10

Best Hits

Swiss-Prot: 48% identical to FER2_AZOVD: Ferredoxin, 2Fe-2s (Avin_01520) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: None (inferred from 60% identity to azo:azo3368)

Predicted SEED Role

"Ferredoxin, 2Fe-2S" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFW0 at UniProt or InterPro

Protein Sequence (107 amino acids)

>Dsui_0571 ferredoxin (Dechlorosoma suillum PS)
MKPKKHVFVCTQGRPPGHPRGSCMQSGGQAVMQAFLNELGGRNAFDRFAVTACGCLGPCD
GGPHVLVYPDGVLYQHVQPGDAGEIFDQHLEFDEPLERLRAPAGVWD