Protein Info for Dsui_0568 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 638 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details amino acids 27 to 28 (2 residues), see Phobius details transmembrane" amino acids 24 to 26 (3 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 339 to 466 (128 residues), 86.4 bits, see alignment E=1.8e-28 PF13188: PAS_8" amino acids 346 to 394 (49 residues), 32.6 bits, see alignment 1.4e-11 PF00989: PAS" amino acids 346 to 456 (111 residues), 56.2 bits, see alignment E=8.4e-19 PF08448: PAS_4" amino acids 350 to 460 (111 residues), 47.8 bits, see alignment E=3.8e-16 PF13426: PAS_9" amino acids 354 to 458 (105 residues), 52.4 bits, see alignment E=1.4e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 466 to 628 (163 residues), 145.9 bits, see alignment E=9.6e-47 PF00990: GGDEF" amino acids 470 to 627 (158 residues), 148.1 bits, see alignment E=5.1e-47

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFV7 at UniProt or InterPro

Protein Sequence (638 amino acids)

>Dsui_0568 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MAIKESWRWIALVLLLVCGIDLRLYFLAQDERQATLARAHATLHTSAKVLLGRMDQLLDT
YDRTLSGIGEAIGAHGGLSRRPDLYLHRLLLRRHAITPGLNWLMLAGTDGRIAELSDRFP
ASDVDDVSQWPFYQLPLRHWEMGLYIGPAQRSPHSNEPFVPVSRRVENDGERLLGVVAGG
INPEQLRRLLEDEDLPPGFALHLLLEDGRALACLPLGPDCLERNWLADPGLARAILAAPH
GPFDNGRVIGDVVGPGAFARSERYPVLVVATADEARVLAPWRDSLPSYWVIALGSNIGLA
ALAYFAYHQLLRRRRALEALREANQGLEARVAQRTAELRQREAQARTFMDTAMDAVVVLD
QERRVLEFNRAAERLFGFRAEELLGRSVEEFMPEQTVPIHRALLAEAAAGHAADGAGHGR
EMLARAADGREFPVEVSIGSTELAGGRVFVGILRDISERKAVEEELQRLATTDGLTGILN
RRAFTAEAERLVALARRHDHPLALFILDADKFKNINDSHGHPVGDQVLQALVRAIGGGLR
QSDVFGRLGGEEFGLLLPQTPPAGAHQLGQRLLQAVRQVRLPLAQGELSFSVSIGASLLA
GPGDDLEAMMHRADAALYAAKAGGRDRLAWEGWQPPAA