Protein Info for Dsui_0558 in Dechlorosoma suillum PS

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 389 to 412 (24 residues), see Phobius details PF13432: TPR_16" amino acids 20 to 80 (61 residues), 27 bits, see alignment E=2.9e-09 amino acids 130 to 168 (39 residues), 22.3 bits, see alignment 9e-08 PF14559: TPR_19" amino acids 25 to 80 (56 residues), 30.5 bits, see alignment 2.2e-10 amino acids 60 to 115 (56 residues), 27.9 bits, see alignment 1.5e-09 PF13176: TPR_7" amino acids 52 to 80 (29 residues), 17.4 bits, see alignment (E = 2.3e-06) PF13181: TPR_8" amino acids 116 to 148 (33 residues), 13.3 bits, see alignment (E = 4.8e-05) PF13431: TPR_17" amino acids 138 to 168 (31 residues), 23 bits, see alignment (E = 4.1e-08) PF01075: Glyco_transf_9" amino acids 357 to 405 (49 residues), 26.1 bits, see alignment 3.2e-09

Best Hits

KEGG orthology group: None (inferred from 52% identity to slt:Slit_0576)

Predicted SEED Role

"FOG: TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFU7 at UniProt or InterPro

Protein Sequence (482 amino acids)

>Dsui_0558 tetratricopeptide repeat protein (Dechlorosoma suillum PS)
MTLPPISASAAARAERRYHQGIACLEAGQGEEAEAHLRQALALAPQLTRARANLGYVLEE
RGAWAEAEAAYRRALAEDPGLGPVWLNLGGLLLSRGRAEEALPVCLQTLSLLPGAAAAWV
NLGAACICLEDFAQGERCLLKALSLEPDRPSAHINLAYLLLRQGRYEAGWECFEARPWYR
ELAAHAHCPRWHGEAPAGRHLLVLCEAGHGDMIQFCRYLPLLRARGARLSLVCQPALVRL
FAALPGVERVIPLADLPAARGDWDAWVPLMSLPRHFATRVDSIPAALPYLQVGAPERQAW
RLRLPAAGLRVGLAWRGNPRFENDGERSLPGLWTLAPLAAVPGIALVSLQKGEAEEEALW
TPAGMRIAALGSELTDFADTAALIANLDLVIAVDTAVAHLAAALGVACWLLLPRYKTDWR
WLEGRQDSPWYPGVMRLFRQERRGDWDEVVSRVAGELAAWADGATPDSGTPALEVGAHGE
GA