Protein Info for Dsui_0554 in Dechlorosoma suillum PS

Annotation: uncharacterized conserved small protein containing a coiled-coil domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 65 PF05082: Rop-like" amino acids 5 to 64 (60 residues), 97.9 bits, see alignment E=1.2e-32

Best Hits

Swiss-Prot: 58% identical to Y3451_AZOC5: UPF0437 protein AZC_3451 (AZC_3451) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: None (inferred from 73% identity to rpb:RPB_0976)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFF4 at UniProt or InterPro

Protein Sequence (65 amino acids)

>Dsui_0554 uncharacterized conserved small protein containing a coiled-coil domain (Dechlorosoma suillum PS)
MSDNPEELKAQIKKLSAQAMTWKMNLHDLSEELPVNWENIMETAQKTHDAYAALTAARQR
LAELG