Protein Info for Dsui_0550 in Dechlorosoma suillum PS

Annotation: nitrogenase molybdenum-iron cofactor biosynthesis protein NifE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 TIGR01283: nitrogenase MoFe cofactor biosynthesis protein NifE" amino acids 5 to 458 (454 residues), 648.9 bits, see alignment E=1.8e-199 PF00148: Oxidored_nitro" amino acids 45 to 444 (400 residues), 362.3 bits, see alignment E=1.5e-112

Best Hits

Swiss-Prot: 70% identical to NIFE_BRADU: Nitrogenase iron-molybdenum cofactor biosynthesis protein NifE (nifE) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02587, nitrogenase molybdenum-cofactor synthesis protein NifE (inferred from 74% identity to mca:MCA0233)

Predicted SEED Role

"Nitrogenase FeMo-cofactor scaffold and assembly protein NifE" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFF0 at UniProt or InterPro

Protein Sequence (485 amino acids)

>Dsui_0550 nitrogenase molybdenum-iron cofactor biosynthesis protein NifE (Dechlorosoma suillum PS)
MSALQQKVASVLEEPGCATNQAKGEKERKAGCKKQLTPGAAAGGCAFDGAKIALQPIVDV
AHLVHGPIACEGNSWDSRHTLSSGSHIYRTGFTTDMNEMDVVYGGEKKLYRAIKEIIDKY
DPPAVFVYQTCLPAMIGDDIEAVCKAAAAKFGKPVIPVNAPGFVGSKNLGNKLGGEALLD
YVIGTREPEYTTPCDINLIGEYNVVGELWQVKPLFDELGIRILATISGDGRYNDIATAHK
ARAAIMLCSQALINVARKMEERYGIPFFEGSFYGVSDMSDALRKISALLVRQGGPADLPE
RAEALIAREEAKAWARLEPYKARLKGKRVLLFTGGVKSWSVVAALQEVGMEIVGTSMRKT
TANDREKVKEIMGTDAHMFDELPPREMYRMLRDSQADVMLSGGRSQFVALKAKTPWVEIN
QERHHALAGYDGIVNLVDEIDKALYNPVWQQVRQPAPWERPDWEQDLEEWQSCNQEECAG
EVCHG