Protein Info for Dsui_0539 in Dechlorosoma suillum PS

Annotation: ABC-type Fe3+-hydroxamate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 40 to 264 (225 residues), 105.4 bits, see alignment E=1.7e-34

Best Hits

Swiss-Prot: 38% identical to BTUF_PHOPR: Vitamin B12-binding protein (btuF) from Photobacterium profundum (strain SS9)

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 69% identity to app:CAP2UW1_1385)

Predicted SEED Role

"Vitamin B12 ABC transporter, B12-binding component BtuF" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFE2 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Dsui_0539 ABC-type Fe3+-hydroxamate transport system, periplasmic component (Dechlorosoma suillum PS)
MKAVLLLSLALCGGAAQAADIVLKDDTGATLRLPAPARRIVSLAPHVTENLFAAGAGGQV
VGTVDYSDYPEAAKKIARVGGYSRLDLEAVAALRPDLIIAWESGNAPGHVAKLRSLGIPV
FISQPNRIEDVAELLEKFGQLAGTSAVANGAAARFRARLAEIRKQYSGQPRVPTFYQIWK
QPLMSVGRQQIISDVISLCGGSNVFGQVEQMAPKVSEEAVLAANPEAIVASGMGDSRPEW
LDDWKRWKQITAVARDNLFFVPPELIQRHTPRILEGAARLCEHLETARHRRPAR