Protein Info for Dsui_0530 in Dechlorosoma suillum PS

Annotation: ABC-type Fe3+-siderophore transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 62 to 83 (22 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 213 to 214 (2 residues), see Phobius details amino acids 234 to 262 (29 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details PF01032: FecCD" amino acids 20 to 323 (304 residues), 290.8 bits, see alignment E=5.6e-91

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 74% identity to dar:Daro_4031)

Predicted SEED Role

"transport system permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFD3 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Dsui_0530 ABC-type Fe3+-siderophore transport system, permease component (Dechlorosoma suillum PS)
MPSRRRALIVIALLVLLAGVSLVVALAVGSISIPPGAVLQGLLGDAEAPGYAVVHNLRLP
RALAAFACGGLLAVAGCLMQVLLRNPLADPYVLGISGGAGVGALVAILLGLSAFGINGLA
FSGALAATFLVFGLAHGDGSWTQTRLLLTGVIVAAGCGALVALMLSLAPEHKLHGMLYWL
MGDLSQATDARPPLLALAAALLLALPFARELNLLARGLATAQALGVAVVRLRRLVYVVAS
LATATAVTTAGSIGFVGLVVPHLVRLAVGNDQRLLLPASALAGGALLALADTLARTVAAP
QQLPVGVLTALIGVPVFLFLLTRAPR