Protein Info for Dsui_0522 in Dechlorosoma suillum PS

Annotation: SSS sodium solute transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 302 to 327 (26 residues), see Phobius details amino acids 362 to 390 (29 residues), see Phobius details amino acids 412 to 431 (20 residues), see Phobius details amino acids 437 to 458 (22 residues), see Phobius details amino acids 469 to 492 (24 residues), see Phobius details amino acids 507 to 525 (19 residues), see Phobius details TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 67 to 476 (410 residues), 203.6 bits, see alignment E=2.9e-64 PF00474: SSF" amino acids 67 to 476 (410 residues), 366.7 bits, see alignment E=7.7e-114

Best Hits

Swiss-Prot: 61% identical to ACTP_PECAS: Cation/acetate symporter ActP (actP) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 75% identity to mag:amb2626)

MetaCyc: 61% identical to acetate/glycolate:cation symporter (Escherichia coli K-12 substr. MG1655)
RXN0-1981; RXN0-5111; TRANS-RXN0-576

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFC6 at UniProt or InterPro

Protein Sequence (557 amino acids)

>Dsui_0522 SSS sodium solute transporter (Dechlorosoma suillum PS)
MRNLSRFLPLLGLLLAAGAAYAGPGTVGEAEKQPLNVAAIAMFVAFVLSTLGITYWAANR
TKSTADFYTAGGGITGFQNGLAIAGDYMSAATLLGLTSMVFAKGYDGFVYIVGFFVGWPI
ILFLMAERLRNLGRFTFADITSYRLDQSKVRTVAAISSLTVVLFYLITQMVGAGQLIKLL
FGLDYEVAVVVVGVLMMVYVTFGGMIATTWVQIIKACLLLGGGTLMMLLAMSHFGFDFET
LVTKATEVHKDGTKIMGPGSLLADPVNAVSLSLGLMFGTAGLPHILMRFFTVPDAKQARK
SVFVATGFIGFFFLVVVLLGMSAIVLVGTNPEFFEGGNVGGKMIGGGNMVAMHLAKFVGG
NIFLGFLSAVAFATILAVVSGLALAGASAISHDIYANVICKGKPKGGSELKVSKIASIFI
GLAAIGLGIMFEKQNLAFMVGLAFGIAASANFPVLILSMYWKGLTTKGAIAGTICGLTAA
VVFVVLSKAVWVTVLGKAQAIFPYDQPALFSMPLAFLIAFVVSKLDTSAQAKREIEAFDD
QYVRAQTGLGAAGASNH