Protein Info for Dsui_0513 in Dechlorosoma suillum PS

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 199 to 218 (20 residues), see Phobius details amino acids 225 to 242 (18 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details amino acids 348 to 367 (20 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 48 to 184 (137 residues), 137.3 bits, see alignment E=5e-44 PF07695: 7TMR-DISM_7TM" amino acids 199 to 399 (201 residues), 179.5 bits, see alignment E=1.3e-56 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 457 to 619 (163 residues), 142.6 bits, see alignment E=4.7e-46 PF00990: GGDEF" amino acids 461 to 617 (157 residues), 159.5 bits, see alignment E=9.4e-51

Best Hits

KEGG orthology group: None (inferred from 52% identity to app:CAP2UW1_3842)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFB7 at UniProt or InterPro

Protein Sequence (624 amino acids)

>Dsui_0513 diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MFHSPSAPRDRPALLWQALLFFLLLLPAVVRAHPLVLDQDDGSFALVPHVEVLEDPGGKL
DLAAVRQAAAAGRFAPAHALGELNFGYSSSAFWLRIPLESRLQRSSPWLLEIAFPSLDRV
ELFLPRADGRVDYQLTGDRLPFAERPYPNRNLVLPLELGPGESLALYLRVESEGSLTLPL
TLWTPDAFRLHNQDAYAGFSLYYGMLLALGLYNLLLFFALRERIYLVYVAFAVSMAVGQL
SLNGLGNEYIWPAFPAWGNVALPSGFAATGFFGAIFTRLFLNTRHSNPRADKLILALAAG
FAVAALGPVLLPYRWAAILTSLLGAAFSAVAVAVGVHAQLRRHPGARYFLLAWSLLLVGV
GMMALRNLGWLPTTLFTSYGMQIGSALEMLLLSFALADRIQAERLARELAQGEALHSKQD
LVNALRSNEQLLEARVAERTRDLAAANDRLLANEQQLQRMARHDPLTGLANRLLLDDRIS
HGLAVGRRNGTRLALLLIDLDGFKPINDEHGHAVGDQLLVVLADRLQRSVRAVDTVARLG
GDEFVLVLEDLAAVEDGRQVAAKVVAEMSRPVVLEGRELLVSASAGLAFYPEDGEDAQTL
LRRADEAMYEAKRAGRNTFRQVGQ